Uso del prodotto: Questo prodotto è destinato esclusivamente alla ricerca.
Tutte le informazioni sui prodotti presenti su questo sito hanno scopo esclusivamente educativo. Qualsiasi forma di introduzione nel corpo di esseri umani o animali è severamente vietata dalla legge. Questo prodotto deve essere maneggiato solo da professionisti abilitati e qualificati. Non è un farmaco, un alimento o un cosmetico e non deve essere etichettato, utilizzato o presentato come tale.
6mg in a Vial
Durante il cambio di confezione potresti ricevere prodotti con l’etichetta precedente o con quella nuova. Formulazione, purezza e qualità restano esattamente le stesse, secondo i nostri standard.
-25% su tutto – fino al 31 Ottobre
25% sui prezzi ordinari, in sostituzione degli altri saldi. Cumulabile solo con lo sconto crypto.
Spedizione in giornata per gli ordini USA effettuati entro le 12:00 EST.
Vedi le condizioni di spedizione →Ogni lotto è testato per purezza, potenza e qualità.
Vedi i risultati di laboratorio →6mg in a Vial
| CAS Number | 154947-66-7 |
|---|---|
| Appearance | Lyophilized Powder |
| Chemical Names | CAMP, IPR001894, CAP-18, CAP18, CRAMP, HSD26, gene FALL39, gene LL37, FALL39, LL37, FALL-39, cathelicidin antimicrobial peptide, Cathelicidins, Cathelicidin, LL-37, 154947-66-7, Ropocamptide, Bac4, All38 peptide, Cathelicidin LL 37, LL-37 (Human), hCAP 18, UNII-3DD771JO2H, LL-37 trifluoroacetate salt, LL-37/hCAP18, 3DD771JO2H, CHEMBL530345, LL 37, Cathelicidin antimicrobial peptide 18, AKOS024458536 |
| Molecular Formula | C205H340N60O53 |
| Sequence | [LL-37, 37 aa] |
| Molecular Weight | 4493 g/mol |
Never received my order. Contacted support and explained the situation and seemed to be helpful initially until I never received my tracking numbers! Followed it up with them and they have been unresponsive. Finally received a response with tracking numbers and hopefully it will be a seamless transaction moving forwards.
Wow Oder came as planned, I was able track it the entire way and made me feel comfortable about my order!
i am extremely happy with the delivery rate and the product!
The research results have been great so far. Super happy with the ordering process and purity is outstanding. Thanks for the outstanding support!
Highly consistent test results. First-class experience with the ordering process and purity is outstanding. I will definitely be back.
Outstanding experience with the ordering process and purity exceeded my expectations. Our research results are completely exceeding expectations. Great value.
We got fantastic research results. Cannot recommend enough the fast turnaround times, the compound is pure and high quality. Highly recommend this vendor.
